General Information

  • ID:  hor004747
  • Uniprot ID:  Q9SV72(58-102)
  • Protein name:  Stomagen
  • Gene name:  EPFL9
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  Plant cysteine rich small secretory peptide family, Epidermal patterning factor subfamily
  • Source:  Plant
  • Expression:  Expressed in immature organs, including leaves, stems and flower buds, but not in roots, shoot apical meristem and petals. Detected in the mesophyll tissues but not in the epidermal tissues where stomata develop.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0019901 protein kinase binding; GO:0033612 receptor serine/threonine kinase binding
  • GO BP:  GO:0007267 cell-cell signaling; GO:0010052 guard cell differentiation; GO:0010374 stomatal complex development; GO:0010375 stomatal complex patterning; GO:2000038 regulation of stomatal complex development; GO:2000123 positive regulation of stomatal complex development
  • GO CC:  GO:0005576 extracellular region; GO:0048046 apoplast

Sequence Information

  • Sequence:  IGSTAPTCTYNECRGCRYKCRAEQVPVEGNDPINSAYHYRCVCHR
  • Length:  45(58-102)
  • Propeptide:  MKHEMMNIKPRCITIFFLLFALLLGNYVVQASRPRSIENTVSLLPQVHLLNSRRRHMIGSTAPTCTYNECRGCRYKCRAEQVPVEGNDPINSAYHYRCVCHR
  • Signal peptide:  MKHEMMNIKPRCITIFFLLFALLLGNYVVQA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  8-8C->S: Incorrect disulfide bonds formation and loss of activity; 13-13C->S: Incorrect disulfide bonds formation and loss of activity; 16-16C->S: Incorrect disulfide bonds formation and loss of activity; 20-20C->S: Incorrect disulfide bonds formation and

Activity

  • Function:  Positively regulates stomatal density and patterning.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  8-41; 13-20; 16-43
  • Structure ID:  2liy(PDB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    2liy.pdbhor004747_AF2.pdbhor004747_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 590775 Formula: C213H331N69O67S6
Absent amino acids: FLMW Common amino acids: C
pI: 8.12 Basic residues: 8
Polar residues: 21 Hydrophobic residues: 8
Hydrophobicity: -74.89 Boman Index: -12126
Half-Life: 20 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 43.33
Instability Index: 5090 Extinction Coefficient cystines: 6335
Absorbance 280nm: 143.98

Literature

  • PubMed ID:  22027592
  • Title:  The NMR Structure of Stomagen Reveals the Basis of Stomatal Density Regulation by Plant Peptide Hormones